PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15814A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 299aa    MW: 32113 Da    PI: 8.707
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15814AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.71.5e-191156147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               rg+W+++Ed+ll ++v+q+G ++W++I r+++ gR++k+c++rw + 
  Oropetium_20150105_15814A 11 RGPWSPQEDDLLRRLVEQHGARNWTAIGREIP-GRSGKSCRLRWCNQ 56
                               89******************************.***********985 PP

2Myb_DNA-binding55.21.6e-1763105145
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                r ++T+eEd  +v+a+++lG++ W++Iar ++ gRt++ +k++w+
  Oropetium_20150105_15814A  63 RRPFTAEEDAAIVRAHARLGNR-WAAIARLLP-GRTDNAVKNHWN 105
                                679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.506661IPR017930Myb domain
SuperFamilySSF466891.2E-308104IPR009057Homeodomain-like
SMARTSM007174.7E-171059IPR001005SANT/Myb domain
PfamPF002491.1E-181156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-251264IPR009057Homeodomain-like
CDDcd001674.42E-161355No hitNo description
SMARTSM007175.3E-1662110IPR001005SANT/Myb domain
PROSITE profilePS5129420.28663112IPR017930Myb domain
PfamPF002498.2E-1563105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2365112IPR009057Homeodomain-like
CDDcd001671.41E-1265105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGVEAECDRI RGPWSPQEDD LLRRLVEQHG ARNWTAIGRE IPGRSGKSCR LRWCNQLSPQ  60
VERRPFTAEE DAAIVRAHAR LGNRWAAIAR LLPGRTDNAV KNHWNCSLKR KLAAANTGAE  120
NAAAKFERPC KRTSVSPDSP SGSGSGSDRS DLSHGASSGS GQIYRPVARS GGFEPVVDCA  180
ISRRHEDEDP LTSLSLSLPG TDNSSGFHHD RAHSQFQELP PSPPAPVPSA ASYPMNPTFM  240
AAMQDLIRTE VQRYMSSVGV RAGCGGAAGA GADMFMPQLM EGVMRAAAER VGSVGRMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-3981124108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965791.11e-150PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-66MYB44_ARATH; Transcription factor MYB44
TrEMBLK3XYD01e-150K3XYD0_SETIT; Uncharacterized protein
STRINGSi006938m1e-150(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.16e-58myb domain protein 73